Protein Info for MMP_RS01520 in Methanococcus maripaludis S2

Annotation: 5-(carboxyamino)imidazole ribonucleotide mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00731: AIRC
  • amino acids 2 to 143 (142 residues), 197.6 bits, E=4e-63
• TIGR01162: phosphoribosylaminoimidazole carboxylase, catalytic subunit
  • amino acids 2 to 152 (151 residues), 198.9 bits, E=1.7e-63

Best Hits

Swiss-Prot: 76% identical to PURE_METJA: N5-carboxyaminoimidazole ribonucleotide mutase (purE) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01588, 5-(carboxyamino)imidazole ribonucleotide mutase [EC: 5.4.99.18] (inferred from 100% identity to mmp:MMP0282)

MetaCyc: 40% identical to N5-carboxyaminoimidazole ribonucleotide mutase (Escherichia coli K-12 substr. MG1655)
5-(carboxyamino)imidazole ribonucleotide mutase. [EC: 5.4.99.18]

Predicted SEED Role

"Phosphoribosylaminoimidazole carboxylase catalytic subunit (EC 4.1.1.21)" in subsystem De Novo Purine Biosynthesis (EC 4.1.1.21)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (17/21 steps found)
• inosine-5'-phosphate biosynthesis III (5/6 steps found)
• inosine-5'-phosphate biosynthesis II (4/5 steps found)
• inosine-5'-phosphate biosynthesis I (4/6 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (17/26 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.21 or 5.4.99.18

Sequence Analysis Tools

See Q6M0I8 at UniProt or InterPro

Protein Sequence (158 amino acids)

>MMP_RS01520 5-(carboxyamino)imidazole ribonucleotide mutase (Methanococcus maripaludis S2)
MITIIMGSKSDVKIAEKAVSILKEFKIDYEVRVASAHRTPELVEEIVKNSKSKVFIAIAG
LAAHLPGVVAAMTTKPVIAVPVESKLDGLDALLSAVQMPPGIPAACVGIDRGENAAILAA
EMLSISDERIEKKLAEFRENQKKKIFSDDAEVSSLFKN