Protein Info for MMP_RS01490 in Methanococcus maripaludis S2

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF13432: TPR_16" amino acids 30 to 91 (62 residues), 20.8 bits, see alignment E=5.4e-07 amino acids 65 to 122 (58 residues), 20.6 bits, see alignment E=6.1e-07 amino acids 139 to 188 (50 residues), 19.3 bits, see alignment 1.5e-06 amino acids 235 to 296 (62 residues), 24.8 bits, see alignment E=2.9e-08 PF13424: TPR_12" amino acids 59 to 123 (65 residues), 34.6 bits, see alignment E=2.1e-11 PF07719: TPR_2" amino acids 59 to 92 (34 residues), 27.1 bits, see alignment 3.4e-09 amino acids 162 to 192 (31 residues), 26.9 bits, see alignment (E = 4e-09) amino acids 197 to 227 (31 residues), 24.4 bits, see alignment (E = 2.6e-08) amino acids 233 to 262 (30 residues), 24 bits, see alignment (E = 3.4e-08) amino acids 298 to 330 (33 residues), 26.3 bits, see alignment 6.6e-09 PF00515: TPR_1" amino acids 59 to 92 (34 residues), 29.7 bits, see alignment 5e-10 amino acids 128 to 160 (33 residues), 32.1 bits, see alignment 8.3e-11 amino acids 162 to 193 (32 residues), 36.2 bits, see alignment 4.5e-12 amino acids 197 to 227 (31 residues), 31.1 bits, see alignment (E = 1.8e-10) amino acids 298 to 330 (33 residues), 31.2 bits, see alignment 1.7e-10 PF13181: TPR_8" amino acids 59 to 92 (34 residues), 21.2 bits, see alignment 2.8e-07 amino acids 94 to 126 (33 residues), 19.1 bits, see alignment 1.3e-06 amino acids 128 to 160 (33 residues), 17.6 bits, see alignment 4e-06 amino acids 162 to 193 (32 residues), 27.8 bits, see alignment 2.2e-09 amino acids 197 to 227 (31 residues), 23.1 bits, see alignment (E = 6.7e-08) amino acids 235 to 262 (28 residues), 17.5 bits, see alignment (E = 4.3e-06) amino acids 265 to 296 (32 residues), 16 bits, see alignment 1.3e-05 amino acids 298 to 330 (33 residues), 31.2 bits, see alignment 1.7e-10 PF13431: TPR_17" amino acids 81 to 114 (34 residues), 28.8 bits, see alignment 1.2e-09 amino acids 149 to 181 (33 residues), 26.3 bits, see alignment 6.9e-09 amino acids 251 to 283 (33 residues), 22.8 bits, see alignment 9.3e-08 PF13374: TPR_10" amino acids 95 to 122 (28 residues), 16.3 bits, see alignment (E = 9.6e-06) PF13176: TPR_7" amino acids 96 to 124 (29 residues), 15.5 bits, see alignment (E = 1.8e-05) PF12895: ANAPC3" amino acids 106 to 186 (81 residues), 29.1 bits, see alignment E=1.2e-09 PF13174: TPR_6" amino acids 197 to 228 (32 residues), 13.2 bits, see alignment 0.00015

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0276)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0J4 at UniProt or InterPro

Protein Sequence (344 amino acids)

>MMP_RS01490 tetratricopeptide repeat protein (Methanococcus maripaludis S2)
MQKIVVFLTVILVLLMAGCIGDQKSKSYNDKGLELYNQGNYVDSISEYNLALLENPKSAE
IWVNKGNSLLKLGIYGESTECFDKALLIDPENSEAFNGLGTVLSKTGNYQKALEMYDKSL
NIDSENSEAWKNKGITLNNMQRYSEAIDCFDKSISINAKNSDVWYNKGETQFKLGEYEKS
IDSYNKALLIDEKMETALLGKGNSYLKLQNYESAIECFNTAETINPKSEYPPYYKADAYR
DTENFEYALKYYDEALEINPSNSDILISKGICLDKMKNYSAAISNFDLAIQLDPKNVQIW
ILKGNSYVGLKDYESSISCYKKALEIEPKNENAKENIDIIEKII