Protein Info for MMP_RS01485 in Methanococcus maripaludis S2

Annotation: right-handed parallel beta-helix repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 892 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF05048: NosD" amino acids 43 to 188 (146 residues), 45.3 bits, see alignment E=1.1e-15 amino acids 166 to 363 (198 residues), 146 bits, see alignment E=1.7e-46 PF13229: Beta_helix" amino acids 68 to 207 (140 residues), 52.4 bits, see alignment E=7.4e-18 amino acids 164 to 288 (125 residues), 64 bits, see alignment E=1.9e-21 amino acids 213 to 339 (127 residues), 47.8 bits, see alignment E=1.8e-16 TIGR03804: parallel beta-helix repeat" amino acids 117 to 160 (44 residues), 41.7 bits, see alignment 3.6e-15 amino acids 168 to 211 (44 residues), 37.7 bits, see alignment 6.2e-14 amino acids 214 to 257 (44 residues), 21.6 bits, see alignment 6.6e-09 amino acids 260 to 302 (43 residues), 35.9 bits, see alignment 2.4e-13 PF17957: Big_7" amino acids 405 to 474 (70 residues), 42.4 bits, see alignment 1.4e-14 amino acids 595 to 662 (68 residues), 43.2 bits, see alignment 7.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0275)

Predicted SEED Role

"Cell surface protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0J5 at UniProt or InterPro

Protein Sequence (892 amino acids)

>MMP_RS01485 right-handed parallel beta-helix repeat-containing protein (Methanococcus maripaludis S2)
MKIFKVFLVMVILGAISGVFAEDTIIYVNDTHYWYQSGAFFESNNSIQDAVEYVPENGVV
EVTTDLKVSNGIEVNKSNIIIDLKGNKLSGNYEGRGISISGNNVSLKNGVVSNFDYGIVL
ENAENCKISNNEVFGNTYDGIYILNSKNNDISENLVYENGVIGIVTSGIFLDGSEFNNIT
KNTVNNNIYNGIELLNSKNNLISGNNVFENEDNGVFVWNSKNNSIIFNELYQNENNGILT
RESKFNTIESNNIFENDDSGIYSWKSFENTISKNKISKNSEGIILWNSDLNVLFKNKLLN
NVKSGISIEFGTKYNTIYDNLFNNSLNVRFEDSGKNYWNAPVINESNILEGEFTAGNVWY
TPECTGFSQKAMNQDTNGDTLSETYYELNSENIDNIPLAPDSVPPVVSIVSPRENAFFGE
NETILVDVSVTDNSEIHSVMLEVDNSYKEIMVQNGTTYSKSLDNLDYGAHTIKIYAEDAV
GNVNFFESRVFSISTPDSTPPEVRIISPVSKSYAEGSEVSIKVQITDESDIYSAYAKIDD
YTVDLIESNGYYINILDNLEWGAHTLWIIVTDAAGNSNYNEKVTFDVNEGDITPPEVEII
EPEIGDSFEENVSIKVSATDDSGIDSVKVMLDEKVSFTLTKNSEYYTGTLTDLSYGIHTL
RVYAEDNEENINSDEVIQFEIEVPDYSYTKPTTDNTQEPAETSNPENKTTDTPLNNETGE
ITPNESENESNGEIENNTNESQNSETQNNTDAGDEGNISDNPSENDSPLEHEDTSDTEPD
NNDEGAEDSGDTTSETGDATGEEPTETSDDEPSETPPETEDTTGDESSDTTSDDNSGGES
ESNSETEDSETSDDEPSDSSSESESNSDASPEDNSDGETSDNSPEESGDSVA