Protein Info for MMP_RS01475 in Methanococcus maripaludis S2

Annotation: phosphosulfolactate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF02679: ComA" amino acids 13 to 246 (234 residues), 300 bits, see alignment E=6.2e-94 TIGR03849: phosphosulfolactate synthase" amino acids 15 to 251 (237 residues), 413.2 bits, see alignment E=1.4e-128

Best Hits

Swiss-Prot: 64% identical to PSLS_METJA: Phosphosulfolactate synthase (comA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K08097, phosphosulfolactate synthase [EC: 4.4.1.19] (inferred from 96% identity to mmx:MmarC6_0679)

MetaCyc: 64% identical to ComA (Methanocaldococcus jannaschii)
Phosphosulfolactate synthase. [EC: 4.4.1.19]

Predicted SEED Role

"Phosphosulfolactate synthase (EC 4.4.1.19)" (EC 4.4.1.19)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0J7 at UniProt or InterPro

Protein Sequence (251 amino acids)

>MMP_RS01475 phosphosulfolactate synthase (Methanococcus maripaludis S2)
MNAFSFLNLEKGTENTMIIDKGLSPDFINDYLKVCGKYITFAKFGWGTSAVQSRELVKEK
IENYKKYGIKTYPGGTLFEVCFSKNLFEEYLKECKDLGFECVEISDGSMELKPEDKDYAI
KQAKKAGFIVLSEVGKKSIVLDSELEIHERIELVKKDLESGADFVIIEGRESGKSIGLFD
EKGNVKKEELEILAENVDMDKIILEAPQKNQQVEFILRFGNDVNLGNISFEEVISLETLR
RGLRGDTFGKI