Protein Info for MMP_RS01440 in Methanococcus maripaludis S2

Annotation: NAAT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details TIGR00427: membrane protein, MarC family" amino acids 1 to 208 (208 residues), 201.4 bits, see alignment E=6.7e-64 PF01914: MarC" amino acids 4 to 212 (209 residues), 193.7 bits, see alignment E=1.2e-61

Best Hits

Swiss-Prot: 37% identical to Y540_AQUAE: UPF0056 membrane protein aq_540 (aq_540) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K05595, multiple antibiotic resistance protein (inferred from 100% identity to mmp:MMP0266)

Predicted SEED Role

"Multiple antibiotic resistance protein marC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0K4 at UniProt or InterPro

Protein Sequence (213 amino acids)

>MMP_RS01440 NAAT family transporter (Methanococcus maripaludis S2)
MDVQFIILAFTSLFSILNPFGVIPTYLVLTSQYSKVEKIKIIRKSMLAAFALLMMFALLG
NQIIGFFGISIPAIKITGGVLLFLIALDMIQGNTSKVEKSPKLESHLKSHSEEIEDMDEI
AIVPLTVPLLTGPGSISAVIAMMAQTSDFDGKLSVIIAISLCIIISYFVLKFSKDLEKML
GKIGFKVLTKMMGLVLTAISIQMALDGILMVFG