Protein Info for MMP_RS01365 in Methanococcus maripaludis S2

Annotation: archaeal proteasome endopeptidase complex subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 TIGR03633: proteasome endopeptidase complex, archaeal, alpha subunit" amino acids 9 to 235 (227 residues), 367.7 bits, see alignment E=1.1e-114 PF10584: Proteasome_A_N" amino acids 10 to 32 (23 residues), 50.9 bits, see alignment (E = 9.5e-18) PF00227: Proteasome" amino acids 33 to 216 (184 residues), 221 bits, see alignment E=1.1e-69

Best Hits

Swiss-Prot: 100% identical to PSA_METMP: Proteasome subunit alpha (psmA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03432, proteasome alpha subunit [EC: 3.4.25.1] (inferred from 100% identity to mmp:MMP0251)

Predicted SEED Role

"Proteasome subunit alpha (EC 3.4.25.1), archaeal" in subsystem Proteasome archaeal (EC 3.4.25.1)

Isozymes

Compare fitness of predicted isozymes for: 3.4.25.1

Use Curated BLAST to search for 3.4.25.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0L9 at UniProt or InterPro

Protein Sequence (259 amino acids)

>MMP_RS01365 archaeal proteasome endopeptidase complex subunit alpha (Methanococcus maripaludis S2)
MQQMVPASGYDRAITIFSPEGRLYQVEYAREAVRRGTTAVGIKCKDGVVLAVDRRITSKL
IDVSSIEKIFQIDDHIVAATSGLVADARVLIDRARIEAQMNRVSYGEAITVEALAKKICD
IKQAYTQHGGARPFGLALLITGIDRHSARLFETDPSGALIEYKATAIGSGRPIAMEVLES
KYDENMTVSEGMELALYALSKTTEELKPENIDMAIIKDSGKLVEKISVDEIEKIVKAVYE
KVKAEEEEAEKNKGEEDSE