Protein Info for MMP_RS01360 in Methanococcus maripaludis S2

Annotation: ribosome assembly factor SBDS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 TIGR00291: rRNA metabolism protein, SBDS family" amino acids 1 to 231 (231 residues), 320.7 bits, see alignment E=2.5e-100 PF01172: SBDS_N" amino acids 6 to 93 (88 residues), 84.9 bits, see alignment E=4.6e-28 PF09377: SBDS_domain_II" amino acids 101 to 162 (62 residues), 84.9 bits, see alignment E=4.3e-28 PF20268: SBDS_C" amino acids 166 to 231 (66 residues), 60.2 bits, see alignment E=2.3e-20

Best Hits

Swiss-Prot: 68% identical to SDO1_METJA: Ribosome maturation protein SDO1 homolog (MJ0592) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07582, hypothetical protein (inferred from 100% identity to mmp:MMP0250)

Predicted SEED Role

"Shwachman-Bodian-Diamond syndrome protein; predicted exosome subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0M0 at UniProt or InterPro

Protein Sequence (234 amino acids)

>MMP_RS01360 ribosome assembly factor SBDS (Methanococcus maripaludis S2)
MVSLDNAVIARLQSHGEKFEILVDPYLAAKFKEGQPIGISEILAAETVYKDSGKGEKVPE
DVLLKIFETLNPLEIAEQILKKGTVQLTANQRKEIQELKRKQIVSIISKNTINPQTDTPH
PPKRIENAMEEARLSVDIYKSAEEQIPKIIKELRKLLPIKFEKRDVAVKILGEFAANAYH
TLHEYGATKQEEWLGDGSLVLVIEIPSGIENEFYMHLNKLTKGTVQTKVLKRYD