Protein Info for MMP_RS01250 in Methanococcus maripaludis S2

Annotation: tRNA (guanine(26)-N(2))-dimethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 373 TIGR00308: N2,N2-dimethylguanosine tRNA methyltransferase" amino acids 4 to 368 (365 residues), 378.3 bits, see alignment E=2.7e-117 PF02005: TRM" amino acids 7 to 362 (356 residues), 363.1 bits, see alignment E=9.9e-113

Best Hits

Swiss-Prot: 100% identical to TRM1_METMI: tRNA (guanine(26)-N(2))-dimethyltransferase (trm1) from Methanococcus maripaludis

KEGG orthology group: K00555, tRNA (guanine-N2-)-methyltransferase [EC: 2.1.1.32] (inferred from 100% identity to mmp:MMP0228)

Predicted SEED Role

"tRNA N2,N2-dimethyl(Guanine26-N2)-methyltransferase (EC 2.1.1.32)" (EC 2.1.1.32)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P0CW65 at UniProt or InterPro

Protein Sequence (373 amino acids)

>MMP_RS01250 tRNA (guanine(26)-N(2))-dimethyltransferase (Methanococcus maripaludis S2)
MKIISEGETKLMVPEESTLSKKDTVFYNPVMETNRDISVSVVQSFLDDFKRDEFLMCDPL
GGSGARGIRYAKELKFNGDLKVSIGDINPSAVKMIKENLKLNELENVEVFHEDANVLLSK
NFKVFNVVDLDPFGSPVPYLDSGIRASLTKGGLLCMTATDTAVLCGAYRKTCIRKYNAVP
LKGDKELAVRLMIGYAVKMASKYDIGLKPIFSHVTDHYARTFMVTERGAGKADSAIENLG
YIRQDSEQKSFKTFEEGSEKGYAGPFYLGEISDKNIVQNALNTAKTRNYSKRAVNILEMI
SRESEINQVGCFDIHELCSFIKKLVPPVNDIMENLKENGFKVTRVHYNPYGLKTDAELSD
LVVLISEYHSKKY