Protein Info for MMP_RS01235 in Methanococcus maripaludis S2

Annotation: iron-containing alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to G1PDH_METMP: Glycerol-1-phosphate dehydrogenase [NAD(P)+] (egsA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00096, glycerol-1-phosphate dehydrogenase [NAD(P)] [EC: 1.1.1.261] (inferred from 100% identity to mmp:MMP0225)

Predicted SEED Role

"Glycerol-1-phosphate dehydrogenase [NAD(P)] (EC 1.1.1.261)" in subsystem Archaeal lipids or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.1.261)

MetaCyc Pathways

C_20,20 CDP-archaeol biosynthesis (3/6 steps found)
archaetidylinositol biosynthesis (3/10 steps found)
archaetidylserine and archaetidylethanolamine biosynthesis (3/11 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)
C_25,25 CDP-archaeol biosynthesis (1/10 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.261

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0P4 at UniProt or InterPro

Protein Sequence (334 amino acids)

>MMP_RS01235 iron-containing alcohol dehydrogenase (Methanococcus maripaludis S2)
MIVIPRYTIIKEKASFRIQEILDNLNLKNPLVITGKNTQKYNKDFDFIYYDEIETSDLEN
IKNYANDYDSVIGIGGGRPIDIGKLIAHKSKKPFLSVPTTASNDGIASPIVSLTQPSYMT
EAPIAIIADIDIIKKSPKKLLSAGMGDIVSNITAVLDWELGKIEKSEKYSDSSGIFSKTI
AIELMDYVLNSNLEEYPKKLVKALIGSGISIAIAHSSRPASGSEHLFSHALDTMKEKYSI
DTNSLHGEQCGVGTLATAQIYLEEGKLEVETFEMLKTSLKVVDAPVTAKQLGFDEEIVIE
ALSSAHALRNRHTILRNGISKEKAREILEKSEII