Protein Info for MMP_RS01195 in Methanococcus maripaludis S2

Annotation: metalloregulator ArsR/SmtB family transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF12840: HTH_20" amino acids 39 to 85 (47 residues), 28.3 bits, see alignment E=1.4e-10 PF01022: HTH_5" amino acids 40 to 84 (45 residues), 52.3 bits, see alignment E=4.1e-18

Best Hits

Swiss-Prot: 35% identical to ZIAR_SYNY3: Transcriptional repressor SmtB homolog (ziaR) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 99% identity to mmp:MMP0217)

Predicted SEED Role

"Cadmium efflux system accessory protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0Q2 at UniProt or InterPro

Protein Sequence (114 amino acids)

>MMP_RS01195 metalloregulator ArsR/SmtB family transcription factor (Methanococcus maripaludis S2)
LSDLCSEYSVRNEKIKDIMEKLPSNEDIVNISNIMNSFGDPNRLKILLALKESELCSCEL
SNIADTSISAISHQLRILRDRKLVKFRKEGKFVYYELYDEKIRDFLEEIVELRK