Protein Info for MMP_RS01145 in Methanococcus maripaludis S2

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 PF00005: ABC_tran" amino acids 30 to 172 (143 residues), 115.7 bits, see alignment E=3.7e-37 PF08402: TOBE_2" amino acids 290 to 366 (77 residues), 26.6 bits, see alignment E=8.1e-10

Best Hits

KEGG orthology group: K02017, molybdate transport system ATP-binding protein [EC: 3.6.3.29] (inferred from 100% identity to mmp:MMP0207)

Predicted SEED Role

"Molybdenum transport ATP-binding protein ModC (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.29

Use Curated BLAST to search for 3.6.3.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0R2 at UniProt or InterPro

Protein Sequence (380 amino acids)

>MMP_RS01145 ABC transporter ATP-binding protein (Methanococcus maripaludis S2)
MILEIDIEKDYYESKKLKKNKTPSFNLKSKFSIDSGSIIVLFGRSGSGKTSTLGCIAGLL
DPDNGRIIVNNEIYYDSDKNINMSPQERNLGYVFQNYALFPHLTVKENIEYGIKHLSEEE
KERRVFELLKLTQIEGLENRYPDQISGGQKQRVALARALAPSPKILLLDEPFSALDMISR
MRLRESLRSIQKELKIPVVFVTHSFEEAFVMAEKVVTFHNGRIQQIGTPEEIFYNPINTN
VAQLVGYINIFSNAEIDYNENSPDFSILDYRDMKMSIKKFNKSMNEVSFGIRPENIKLID
INSEKTENVFECIIKDVVNEGSTSLVYLEVIQNGLRLMSKTQNDKFKKLNYAVGEKCKIE
LLKDKITILMTQSVKKIDLT