Protein Info for MMP_RS01025 in Methanococcus maripaludis S2

Annotation: DUF120 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01982: CTP-dep_RFKase
  • amino acids 7 to 127 (121 residues), 114.9 bits, E=1.1e-37

Best Hits

Swiss-Prot: 99% identical to RIFK_METMP: Riboflavin kinase (ribK) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K07732, riboflavin kinase, archaea type [EC: 2.7.1.161] (inferred from 99% identity to mmp:MMP0184)

MetaCyc: 50% identical to CTP-dependent riboflavin kinase (Methanocaldococcus jannaschii)
CTP-dependent riboflavin kinase. [EC: 2.7.1.161]

Predicted SEED Role

"CTP-dependent archaeal riboflavin kinase" in subsystem Riboflavin, FMN and FAD metabolism

MetaCyc Pathways

• flavin biosynthesis II (archaea) (8/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.161

Sequence Analysis Tools

See Q6M0T4 at UniProt or InterPro

Protein Sequence (127 amino acids)

>MMP_RS01025 DUF120 domain-containing protein (Methanococcus maripaludis S2)
LEIFGHVVSGLGEGKFFVGLTHYKNKFEELTGFTPFEGTLNVKLKHNFNLDEFNPIEFDG
FEIDGKKYFGGKVLLIKLFNKQGNSINCAVVAPKKTDHSKKTLEIIAPIQLRKFLLLKNS
DVVKLVI