Protein Info for MMP_RS00970 in Methanococcus maripaludis S2

Annotation: coenzyme F430 synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0173)

Predicted SEED Role

"methanogen enzyme similar to murein synthesis amino acid ligase"

Sequence Analysis Tools

See Q6M0U5 at UniProt or InterPro

Protein Sequence (400 amino acids)

>MMP_RS00970 coenzyme F430 synthase (Methanococcus maripaludis S2)
MLIVDINHGALDLALEYEKSGKVPVIWDIYGKLERDKNFKEENKNILSKFKIISKKETPE
FSNYNEVIAPVHCPIDVKFKTFHDAVSEIISKKYPKTVEKMITVTGVKGKTTTTELLKHI
LSEKYSVFCHNSSDGSITPVTVLNILNKLSEEKKLQIYDFLIFEISLGIVSSNYSILTNI
LENYSIAGGKRQASIKIYSLKNSKIAFVNEDLKNRFEIYHKNLKIVKNAKIISKYPLKFN
YLKNDFEFNESVFGSHFIENSVFAIELCSYFMSFGEIKNSLKSFEIKNRMNVETKNNYAI
VKNINPGLDLKAIDYAIFDFLNLFETGTIIVGGDLGCTCEEINIKKLADLIKKYDRDGVK
FLLSGSVGKSLKEIINLEFVDINNYAVEENTLVIYRSNLC