Protein Info for MMP_RS00925 in Methanococcus maripaludis S2

Annotation: sirohydrochlorin nickelochelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06180: CbiK
  • amino acids 2 to 80 (79 residues), 33.9 bits, E=2.2e-12
• PF01903: CbiX
  • amino acids 9 to 138 (130 residues), 91.2 bits, E=5.1e-30

Best Hits

Swiss-Prot: 100% identical to CFBA_METMP: Sirohydrochlorin cobaltochelatase (cbiX) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03795, sirohydrochlorin cobaltochelatase [EC: 4.99.1.3] (inferred from 100% identity to mmp:MMP0164)

Predicted SEED Role

"Sirohydrochlorin cobaltochelatase (EC 4.99.1.3)" in subsystem Coenzyme B12 biosynthesis or Experimental tye (EC 4.99.1.3)

MetaCyc Pathways

• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• siroheme biosynthesis (4/4 steps found)
• factor 430 biosynthesis (4/7 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.99.1.3

Sequence Analysis Tools

See P61819 at UniProt or InterPro

Protein Sequence (144 amino acids)

>MMP_RS00925 sirohydrochlorin nickelochelatase (Methanococcus maripaludis S2)
MEALVLVGHGSRLPHSKNVVMEVAEKIKARNIYDIVEVGMMEFNEPTIPQTIKKVIDAGA
KKVIVTPVFLAPGNHTERDIPKILGIYEGDDEGGHHHHHDHEHHHHHHDTTAVEIPEGVE
LVYRKPMGADDRIIDIVLDRANGL