Protein Info for MMP_RS00920 in Methanococcus maripaludis S2

Annotation: TRC40/GET3/ArsA family transport-energizing ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF02374: ArsA_ATPase" amino acids 24 to 331 (308 residues), 389.7 bits, see alignment E=2e-120 PF01656: CbiA" amino acids 27 to 248 (222 residues), 35.5 bits, see alignment E=1.8e-12 TIGR00345: transport-energizing ATPase, TRC40/GET3/ArsA family" amino acids 28 to 330 (303 residues), 413.5 bits, see alignment E=3.1e-128 PF13614: AAA_31" amino acids 30 to 165 (136 residues), 34.7 bits, see alignment E=3.4e-12

Best Hits

Swiss-Prot: 77% identical to ARSA_METJA: Putative arsenical pump-driving ATPase (MJ1142) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01551, arsenite-transporting ATPase [EC: 3.6.3.16] (inferred from 100% identity to mmp:MMP0163)

Predicted SEED Role

"Arsenical pump-driving ATPase (EC 3.6.3.16)" in subsystem Arsenic resistance (EC 3.6.3.16)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0V5 at UniProt or InterPro

Protein Sequence (345 amino acids)

>MMP_RS00920 TRC40/GET3/ArsA family transport-energizing ATPase (Methanococcus maripaludis S2)
LVLSKIKESLKGITSKKLEKENGTKYIMFGGKGGVGKTTMSAATGIYCAEQGLKTVVVST
DPAHSLKDSFEQSFGHEPTKVNGMENLYVVEIDPEVAMSEYKEKLKSQMDENPMMGGMLE
DQLEMASLSPGTDESAAFDVFLKYMDNNEFDVVVFDTAPTGHTLRFLGLPELMDKYMTKM
IKFKKQMSGFMNMMKKVMPFGGKGEDVDYDKALEEMEEMKARITKARGILANPERTAFRL
VVIPEEMSILESERAMESLNKFKIPVDSVVVNQIIPEDVECDFCRARRSLQEKRLELVKE
KFGDKVIANLELLRTEAKGLDVLKDIAHKLYGEAKSEEEKEVIVA