Protein Info for MMP_RS00880 in Methanococcus maripaludis S2

Annotation: ribosome assembly RNA-binding protein YhbY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 TIGR00253: putative RNA-binding protein, YhbY family" amino acids 10 to 113 (104 residues), 96.9 bits, see alignment E=3.9e-32 PF01985: CRS1_YhbY" amino acids 10 to 93 (84 residues), 74.2 bits, see alignment E=4.2e-25

Best Hits

Swiss-Prot: 54% identical to Y652_METJA: Probable RNA-binding protein MJ0652 (MJ0652) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07574, RNA-binding protein (inferred from 100% identity to mmp:MMP0155)

Predicted SEED Role

"FIG004454: RNA binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0W3 at UniProt or InterPro

Protein Sequence (127 amino acids)

>MMP_RS00880 ribosome assembly RNA-binding protein YhbY (Methanococcus maripaludis S2)
MTENTEVKISSKAKKILRSQSHEIEPVVWVGKEGIEKTIEEIKRQIKDKSLIKIKVRKSA
LENGDKAEMAEKISKETGAEVISVVGNVITIFKPKEGWKKYSTKKTKKEKYVEEFEEMRS
KKALLKR