Protein Info for MMP_RS00870 in Methanococcus maripaludis S2

Annotation: homocitrate synthase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR02090: isopropylmalate/citramalate/homocitrate synthases" amino acids 19 to 380 (362 residues), 561.7 bits, see alignment E=3.6e-173 PF00682: HMGL-like" amino acids 19 to 276 (258 residues), 275.8 bits, see alignment E=3.7e-86 PF22617: HCS_D2" amino acids 290 to 367 (78 residues), 85.8 bits, see alignment E=2.2e-28

Best Hits

Swiss-Prot: 76% identical to AKSA_METJA: Probable homocitrate synthase AksA (aksA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K10977, trans-homoaconitate synthase [EC: 4.1.3.-] (inferred from 100% identity to mmp:MMP0153)

Predicted SEED Role

"Coenzyme B synthesis from 2-oxoglutarate: steps 1, 6, and 10" in subsystem Coenzyme B synthesis

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.-

Use Curated BLAST to search for 4.1.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0W5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>MMP_RS00870 homocitrate synthase family protein (Methanococcus maripaludis S2)
MDWKAVSPYNPKLDLKDCYLYDTTLRDGEQTPGVCFAGDQKLEIAKKLDELKIKQIEAGF
PIVSENERKAIKSITGEGLNAQILALSRVLKEDIDKAIECDVDGIITFIATSPMHLKYKL
HKNLDEVEEMGMKAVEYAKDHGLFVAFSAEDATRTPLEDIIRIHKNAEEHGADRVHIADT
LGCATPQAMYHICSELSKHLKKAHIGVHCHNDFGFAVINSIYGLIGGAKAVSTTVNGIGE
RAGNAAIEEIAMALKVLYDHDMGLNTEILTEISKLVENYSKIKIPENKPLVGEMVFYHES
GIHVDAVLENPLTYEPFLPEKIGQKRKIILGKHSGCRAVAHRLQELGLEASRDELWEIVK
KTKETREDGTEISDEVFKNIAEKIIK