Protein Info for MMP_RS00725 in Methanococcus maripaludis S2

Annotation: 5 10-methenyltetrahydromethanopterin hydrogenase cofactor biosynthesis protein HmdC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 PF10113: Fibrillarin_2" amino acids 1 to 508 (508 residues), 745.2 bits, see alignment E=1.7e-228 TIGR03958: 5,10-methenyltetrahydromethanopterin hydrogenase cofactor biosynthesis protein HmdC" amino acids 1 to 509 (509 residues), 870.5 bits, see alignment E=1.8e-266

Best Hits

Swiss-Prot: 65% identical to Y787_METJA: Uncharacterized protein MJ0787 (MJ0787) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0125)

Predicted SEED Role

"Uncharacterized protein MJ0787"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M0Z3 at UniProt or InterPro

Protein Sequence (510 amino acids)

>MMP_RS00725 5 10-methenyltetrahydromethanopterin hydrogenase cofactor biosynthesis protein HmdC (Methanococcus maripaludis S2)
MKELIKNSLNDLDSAMELRELVINKINNQKLTESDIIEIVDTVDDLSFEDTQKLGSIFRR
FPLGCDLLEIGVGPCSSSLTLPQFIENCVFTDHMGFPIHLCGYALADIAEKEGLTPIEVM
NEVYNNVEVPLDLDHFGRFGPMRFPKEISHCMGDCYYNGPPYKGCPRDRIHKRLITKERE
YSNEFGEWIKKSATVCVNVVEEQGGGDHGADISEMEDVAKAAQKFGRGVEGIFHIGDGYE
DLITGLKACNDLDVDVLVIEGGPFNRSKDRLKDFAKSVAVSRILVKGGVVATNGAYEDEC
RVGLRSGLNVILSGFSGNHHGYMCGYNIKEARRNNFGLPRVLKIMKEEAEKINICIANRE
LLKVLARSSRFLNHNENHLVYPSMIGDYFIGDAHWVSITNSKMYNAPYFGKTLDSLEEEL
NCDKVGVLGGRYISWGIADALKPEELYVSDVDPWVEHATVKILNDNGINAYACNGNDKKA
LESAEKSVITTMIPEIVLRIKNKFDAVSLL