Protein Info for MMP_RS00685 in Methanococcus maripaludis S2

Annotation: 2-phospho-L-lactate guanylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 TIGR03552: 2-phospho-L-lactate guanylyltransferase" amino acids 4 to 196 (193 residues), 202 bits, see alignment E=3.8e-64 PF01983: CofC" amino acids 4 to 221 (218 residues), 221.2 bits, see alignment E=9.7e-70 PF12804: NTP_transf_3" amino acids 34 to 143 (110 residues), 33 bits, see alignment E=6.8e-12

Best Hits

Swiss-Prot: 100% identical to COFC_METMP: 2-phospho-L-lactate guanylyltransferase (cofC) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K14941, 2-phospho-L-lactate guanylyltransferase [EC: 2.7.7.68] (inferred from 100% identity to mmp:MMP0117)

Predicted SEED Role

"CofC, F420 2-Phospho-l-lactate Guanylyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.68

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M101 at UniProt or InterPro

Protein Sequence (222 amino acids)

>MMP_RS00685 2-phospho-L-lactate guanylyltransferase (Methanococcus maripaludis S2)
MLAALIPVSPLSNVKSRLKDFLSSGERIELIKNILLDTYETVKECADACYVVSKDEEILE
FSKNLGIIPIREDSNVKGLNEAINFSLNFIKEESILITPADVPLLKEVNLKAITSKSVKN
SIVICPSRGGGTNLLLLNPKNCMKTQFEGFSFLKHIEEAEKNDLKVIKCHSFYTSIDVNT
VEDLGEIYIHGTDTKTYAYLKSLGVDVLPKHSSAGRFNVIRK