Protein Info for MMP_RS00660 in Methanococcus maripaludis S2

Annotation: alkaline phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01676: Metalloenzyme
  • amino acids 1 to 396 (396 residues), 147.3 bits, E=9.3e-47
• TIGR00306: phosphoglycerate mutase (2,3-diphosphoglycerate-independent), archaeal form
  • amino acids 4 to 396 (393 residues), 381.8 bits, E=2.3e-118
• PF10143: PhosphMutase
  • amino acids 37 to 216 (180 residues), 140.7 bits, E=7e-45

Best Hits

Swiss-Prot: 56% identical to APGM2_METJA: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase 2 (apgM2) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 100% identity to mmp:MMP0112)

Predicted SEED Role

"2,3-bisphosphoglycerate-independent phosphoglycerate mutase, archaeal type (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• glycolysis V (Pyrococcus) (10/10 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• Rubisco shunt (8/10 steps found)
• glycolysis IV (8/10 steps found)
• gluconeogenesis I (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• glycolysis III (from glucose) (8/11 steps found)
• homolactic fermentation (8/12 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• Bifidobacterium shunt (10/15 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• superpathway of glucose and xylose degradation (10/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
• superpathway of hexitol degradation (bacteria) (10/18 steps found)
• glycerol degradation to butanol (8/16 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (10/19 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
• photorespiration II (3/10 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (13/26 steps found)
• superpathway of N-acetylneuraminate degradation (10/22 steps found)
• ethene biosynthesis V (engineered) (12/25 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Sequence Analysis Tools

See Q6M106 at UniProt or InterPro

Protein Sequence (426 amino acids)

>MMP_RS00660 alkaline phosphatase family protein (Methanococcus maripaludis S2)
MRTLLLLLDGLGDRPSEVLKDKTPLEYAKTPNLDAFAKKSVTGMMTPYKKGVPLGTEVAH
FLLWGYKLSEFPGRGVIEALGEDIKLKDNSIYLRATFGYVKRNNGFFVKDRRTKNISIEE
IKQLINSLPKKIGDYEFNLHYSFDTHCILEIRSSNYEISDKISDSDPFYRERHVLKVKPL
KNISERIEIENAVKTAEVLNKYLLKCSEILENHPVNIKRKEKNLQLANFLLTKWAGRYRE
IDSFHDKWGMNAAIIAKSSVFKGLSKLLKMDYYPEGDFQKAFLKGIELKNYDFVHIHTKE
PDEAGHTKNPINKVEVIEKIDKCLKKINELNDELIIVTADHSTPSVGTLIHSGEDVPLAI
FKNGIIKDRVEYFNEKECSKGYINIKSKDLMNLILNDTNKTRPYTTRIGNKLLNYIPENK
SIEHLK