Protein Info for MMP_RS00560 in Methanococcus maripaludis S2

Annotation: cation:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 51 (21 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 155 to 177 (23 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 240 to 256 (17 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 13 to 384 (372 residues), 179.6 bits, see alignment E=4.5e-57

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0100)

Predicted SEED Role

"NapA-2 Na+/H+ antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M118 at UniProt or InterPro

Protein Sequence (392 amino acids)

>MMP_RS00560 cation:proton antiporter (Methanococcus maripaludis S2)
MDISWVLFTIGIAIIFGKLGDHLMNKLGFPGVLGEMIMGMILGNLVYFGLVSPDHLTIQN
NEIFDFLSRLGIIFLLFLGGLDTDLSVLKKTGKIATVSTVFGVLVPLVMGYLALQYMGYT
AAESFAGGVVLTATSIGITVRVMMDMGVLKSEVGAASLSASIMDDFLGIMLIIFAVGTGS
ILGLLGKFAIFFIITGFLAMKLVNKFISFSEKLHVEKGILSLAIAVMFLFSFLAENWFEA
AIEGSFMAGLVLSRTAEGKNLIEDVKTIGYSILIPLFFVYTGASLNLTIFGDFDALYLAL
VLTAIAIVSKVVGRGFGARIMGWNMKKSLQMGIGSIPRAEIALINLMVAIHAGVISESNV
GKFIAATMIFITISIISTPPLLKWAFTEEVEN