Protein Info for MMP_RS00520 in Methanococcus maripaludis S2

Annotation: RNA polymerase Rpb4 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF03874: RNA_pol_Rpb4" amino acids 24 to 105 (82 residues), 31.7 bits, see alignment E=8.3e-12

Best Hits

Swiss-Prot: 53% identical to Y039_METJA: Uncharacterized protein MJ0039 (MJ0039) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03051, DNA-directed RNA polymerase subunit F [EC: 2.7.7.6] (inferred from 95% identity to mmz:MmarC7_1091)

Predicted SEED Role

"DNA-directed RNA polymerase subunit F (EC 2.7.7.6)" in subsystem RNA polymerase archaeal (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M126 at UniProt or InterPro

Protein Sequence (107 amino acids)

>MMP_RS00520 RNA polymerase Rpb4 family protein (Methanococcus maripaludis S2)
MIGKEIISEKYTTIAHATEIMDERADFDELSYEHGCSLDYLRKFSTISKDDADAMFEQLV
NLGLTEKMAVKIIDLLPETEEDLKIIFYRVDVPENKDEILEVVSKFK