Protein Info for MMP_RS00500 in Methanococcus maripaludis S2

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR01035: glutamyl-tRNA reductase" amino acids 2 to 360 (359 residues), 370.6 bits, see alignment E=5.3e-115 PF05201: GlutR_N" amino acids 4 to 132 (129 residues), 105.3 bits, see alignment E=7.9e-34 PF01488: Shikimate_DH" amino acids 147 to 275 (129 residues), 145.3 bits, see alignment E=4e-46 PF02826: 2-Hacid_dh_C" amino acids 150 to 226 (77 residues), 27.7 bits, see alignment E=4.9e-10 PF13241: NAD_binding_7" amino acids 155 to 228 (74 residues), 23.2 bits, see alignment E=2.6e-08 PF03807: F420_oxidored" amino acids 161 to 251 (91 residues), 36 bits, see alignment E=2.6e-12 PF00745: GlutR_dimer" amino acids 290 to 362 (73 residues), 44 bits, see alignment E=7.1e-15

Best Hits

Swiss-Prot: 100% identical to HEM1_METMP: Glutamyl-tRNA reductase (hemA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 100% identity to mmp:MMP0088)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M130 at UniProt or InterPro

Protein Sequence (382 amino acids)

>MMP_RS00500 glutamyl-tRNA reductase (Methanococcus maripaludis S2)
MLVVRADYKKYPIPVLEKMRIDEDEFYKKYDACVVVQTCNRIEAYFDTEVNSDLNCILND
FSGFDILKGKNATFHFLKVSCGMDSMILGENQILGQIKTSFQKARELKKTSRYLDSVFLK
AIHVGQRARTETKINEGSVSIGSAAVELAEKNFGLANKNVLLIGAGEIGTLVAKALMEKH
IKAVIVANRTYERAETLAKELKGMAVHFDKLKEAINFSDVIICATSSPHYILKKEDLIDV
GNKIIIDIANPRDVDDAVREFENINLYTIDDLRNISDKNLQKRIEEVPAVEKIIDEEYDV
LMKQIEKINVEEVLKDFNNYIEEIRTKELEKAIKLSKTKNPEEIMENFSKAFAKRITHDF
VSYSINTSKEDLMNSAWWKNGK