Protein Info for MMP_RS00490 in Methanococcus maripaludis S2

Annotation: Tfx family DNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 TIGR00721: DNA-binding protein, Tfx family" amino acids 1 to 133 (133 residues), 168.2 bits, see alignment E=4.5e-54 PF04545: Sigma70_r4" amino acids 5 to 47 (43 residues), 29.9 bits, see alignment E=3.3e-11 PF14601: TFX_C" amino acids 50 to 132 (83 residues), 96.5 bits, see alignment E=7.4e-32

Best Hits

Swiss-Prot: 100% identical to Y086_METMP: Putative transcriptional regulatory protein MMP0086 (MMP0086) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K09714, hypothetical protein (inferred from 100% identity to mmp:MMP0086)

Predicted SEED Role

"DNA-binding protein tfx"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M132 at UniProt or InterPro

Protein Sequence (149 amino acids)

>MMP_RS00490 Tfx family DNA-binding protein (Methanococcus maripaludis S2)
MESFLTEIQINVLNLRKRGHTQDEIANIMGTSRANISMIEKRARENIEKARNTLSIYNDI
IAPSKIKIDKGTDVFSIPKIIFSKSDQEEIHVNYSSLQIMEFVNQNAQRYIKNRMVVEPF
VVTILQNGDIFVHDYEESEENEKMPKKEI