Protein Info for MMP_RS00385 in Methanococcus maripaludis S2

Annotation: P-II family nitrogen regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF00543: P-II" amino acids 1 to 106 (106 residues), 99.3 bits, see alignment E=7.4e-33

Best Hits

Swiss-Prot: 70% identical to Y059_METJA: Uncharacterized nitrogen regulatory PII-like protein MJ0059 (MJ0059) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04751, nitrogen regulatory protein P-II 1 (inferred from 100% identity to mmp:MMP0067)

MetaCyc: 52% identical to nitrogen regulatory protein PII-1 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Nitrogen regulatory protein P-II" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M150 at UniProt or InterPro

Protein Sequence (112 amino acids)

>MMP_RS00385 P-II family nitrogen regulator (Methanococcus maripaludis S2)
MKKLEAIIRMERVGLVKNALYKSGHASLTLTEVKGRGVQGGIVERYRGTEHVVDLLPKVK
IELVVNEKDVDSVIKIIAENAYTGKPGDGKIFVIPVEDVCRVRTGEMGPDAI