Protein Info for MMP_RS00375 in Methanococcus maripaludis S2

Annotation: ammonium transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 26 to 46 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 139 to 158 (20 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 211 to 228 (18 residues), see Phobius details amino acids 234 to 260 (27 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 290 to 310 (21 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details TIGR00836: ammonium transporter" amino acids 25 to 405 (381 residues), 353.6 bits, see alignment E=6.9e-110 PF00909: Ammonium_transp" amino acids 28 to 405 (378 residues), 352.2 bits, see alignment E=1.7e-109

Best Hits

Swiss-Prot: 74% identical to Y1343_METJA: Putative ammonium transporter MJ1343 (MJ1343) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0065)

Predicted SEED Role

"Putative ammonium transporter MJ1343"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M152 at UniProt or InterPro

Protein Sequence (408 amino acids)

>MMP_RS00375 ammonium transporter (Methanococcus maripaludis S2)
MATADLFADPTNIVTGLSTLATSGDVMFLVLMGVLVFSMQLGFALLEGGQVRKKNVNNVM
MKNMADWLIGAVSWLFIGGVLSVSLVPADFFSWWGQIFTTNFANNGIDLANWFFGLVFAA
TAATIVSGGVAERIKFKSYLLMSIIITAILYPLFVYLGPWGSGMIPFNDYAGSFVVHGLG
GFLALGAIAALGPRIGKFVNKKAISIPGHNIPMSVFGAFVLAIGWYGFNVGSSFAVADIS
GLVCATTTLAMAGGGIGALLASKDDVLFTANGIVAGLVAICSGTDVVSPIGALIIGLVAG
IQVPIVYKIVEKMGLDDVCGVIPVHGTAGILGGILTGVFGMAALGGAGGVSLVNQLIAAG
LTVVYGTGLGFGLGKLVGGFTGGLRVTEEEEKMGLDLAEHKLPAYPDE