Protein Info for MMP_RS00340 in Methanococcus maripaludis S2

Annotation: 5 10-methylenetetrahydromethanopterin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 77% identical to MER_METJA: 5,10-methylenetetrahydromethanopterin reductase (mer) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00320, coenzyme F420-dependent N5,N10-methenyltetrahydromethanopterin reductase [EC: 1.5.99.11] (inferred from 100% identity to mmp:MMP0058)

MetaCyc: 66% identical to Mer (Methanothermobacter thermautotrophicus)
METHELENE-THMPT-OXI-RXN [EC: 1.5.98.2]

Predicted SEED Role

"F420-dependent N(5),N(10)-methylenetetrahydromethanopterin reductase (EC 1.5.99.11)" in subsystem Methanogenesis (EC 1.5.99.11)

MetaCyc Pathways

gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
methanogenesis from H₂ and CO₂ (6/6 steps found)
methyl-coenzyme M oxidation to CO₂ II (6/6 steps found)
methyl-coenzyme M oxidation to CO₂ I (5/6 steps found)
reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
methoxylated aromatic compound degradation II (6/9 steps found)
superpathway of methanogenesis (11/21 steps found)
Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)

KEGG Metabolic Maps

Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.98.2 or 1.5.99.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M159 at UniProt or InterPro

Protein Sequence (320 amino acids)

>MMP_RS00340 5 10-methylenetetrahydromethanopterin reductase (Methanococcus maripaludis S2)
MKFGIEFVPNEPITKLAYYVKLAEDNGFEFCWITDHYNNRNVYMTLGNLAAATNKIKLGP
GVTNPYVRSPAIAASAMATVDELSGGRATFGIGPGDKATFDALGIEWTKPVGTIKKAIAD
FKELTAGKRMAEGAQLAVKPSAKIPIYMGAQGPKMLETAGEIADGVLINASNPKDFEAAV
PLIKKGAEAAGRSMSEIDVAAYACMSVDKKAEKAKQAAIPVVAFIAAGSPPMILERHGID
PAKVDAIRAGLKEGNFGAAFGNVDENMLEGFALYGTPEEVVEKVKALEKMGVTQVVAGSP
IGPNKDTSIKLIGKIIKEFQ