Protein Info for MMP_RS00325 in Methanococcus maripaludis S2

Annotation: RNA-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 TIGR03684: arCOG04150 universal archaeal PUA-domain protein" amino acids 6 to 159 (154 residues), 206.7 bits, see alignment E=1.6e-65 PF09183: DUF1947" amino acids 6 to 71 (66 residues), 36.2 bits, see alignment E=8.3e-13 TIGR00451: uncharacterized domain 2" amino acids 48 to 154 (107 residues), 123.4 bits, see alignment E=4.4e-40 PF01472: PUA" amino acids 79 to 152 (74 residues), 77 bits, see alignment E=1.3e-25 PF26292: PUA_elF2D" amino acids 87 to 155 (69 residues), 53 bits, see alignment E=3.6e-18

Best Hits

Swiss-Prot: 57% identical to Y1432_METJA: Uncharacterized protein MJ1432 (MJ1432) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07575, PUA domain protein (inferred from 100% identity to mmp:MMP0055)

Predicted SEED Role

"conserved protein with predicted RNA binding PUA domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M162 at UniProt or InterPro

Protein Sequence (159 amino acids)

>MMP_RS00325 RNA-binding protein (Methanococcus maripaludis S2)
MEIKRRYMLKKKELKELKEELGNIFDVEKIIPKKAVVEKAVTEEGEIILLDGTPLAMVNS
GRIFPTLKFLLEMDIENNRVIVDMGAVKFIANGADIMAPGIVGADEDIKEGDIVFVVDVT
HKKPLSVGEALMDGKTMVEEKKGKAIKTIHFIGDEIWKM