Protein Info for MMP_RS00305 in Methanococcus maripaludis S2

Annotation: phosphoribosyl-ATP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01503: PRA-PH
  • amino acids 4 to 94 (91 residues), 87.8 bits, E=2.6e-29
• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 4 to 90 (87 residues), 100.2 bits, E=2.9e-33

Best Hits

Swiss-Prot: 100% identical to HIS2_METMP: Phosphoribosyl-ATP pyrophosphatase (hisE) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 94% identity to mmq:MmarC5_1629)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• L-histidine biosynthesis (9/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

See P62348 at UniProt or InterPro

Protein Sequence (96 amino acids)

>MMP_RS00305 phosphoribosyl-ATP diphosphatase (Methanococcus maripaludis S2)
MNVLKEVYATIEKRIEEKPEGSYVAKLTTDDKKTAVNKICEKVGEEAAEVIIAAKDNDKA
EIIYESADLIFHTMVLLAKSGITYEELSEEFKKRMK