Protein Info for MMP_RS00225 in Methanococcus maripaludis S2

Annotation: ATP-grasp domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF02655: ATP-grasp_3" amino acids 105 to 262 (158 residues), 163.4 bits, see alignment E=9.6e-52 PF08443: RimK" amino acids 106 to 279 (174 residues), 21 bits, see alignment E=4.5e-08 PF14398: ATPgrasp_YheCD" amino acids 108 to 168 (61 residues), 27 bits, see alignment E=5.3e-10

Best Hits

Swiss-Prot: 51% identical to Y776_METJA: Uncharacterized protein MJ0776 (MJ0776) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K06913, (no description) (inferred from 100% identity to mmp:MMP0035)

MetaCyc: 51% identical to 4-(beta-D-ribofuranosyl)hydroxybenzene 5'-phosphate--L-aspartate ligase (Methanocaldococcus jannaschii)
6.3.1.-

Predicted SEED Role

"Predicted ATP-dependent carboligase related to biotin carboxylase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M182 at UniProt or InterPro

Protein Sequence (349 amino acids)

>MMP_RS00225 ATP-grasp domain-containing protein (Methanococcus maripaludis S2)
MKALVVGACTRPVVNSLKKLNFEVYSVSHYNPVDLNADHKKYTINDKFHGHLADKYSEKE
LLNLSKEYVDLVDYIFVCSGIFESKTSKTPNWDVVGNSPKRIKNISDKYKTVKKLENLGF
NVPVTYLVNNKYQFEKCLSELKSVVVKPISGSGGIGVTNIDFQNTDNLDINYPVLVQERI
KSESYSASFIGSNFLCFNKQLINNNIYVGNISPYVLNLKNETIQEFEEVIASLDLLGMNG
IDFMLKDGIPYIIEVNPRILGTYETIELSSRYNLSKAILENKPVKPKDCFFKKIVFSDKG
SSYSIDKNPFLRDIPQKGTYIEEGEPVVTIIGRNMADVREMECGILRGV