Protein Info for MMP_RS00220 in Methanococcus maripaludis S2

Annotation: GTP cyclohydrolase MptA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 PF02649: GCHY-1" amino acids 4 to 297 (294 residues), 262.4 bits, see alignment E=2.4e-82 TIGR00294: GTP cyclohydrolase" amino acids 5 to 312 (308 residues), 419.8 bits, see alignment E=2.9e-130

Best Hits

Swiss-Prot: 100% identical to MPTA_METMP: GTP cyclohydrolase MptA (mptA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K09007, hypothetical protein (inferred from 100% identity to mmp:MMP0034)

MetaCyc: 66% identical to GTP cyclohydrolase monomer (Methanocaldococcus jannaschii)
RXN-10063 [EC: 3.5.4.39]

Predicted SEED Role

"GTP cyclohydrolase I (EC 3.5.4.16) type 2" in subsystem Folate Biosynthesis or Queuosine-Archaeosine Biosynthesis (EC 3.5.4.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.16 or 3.5.4.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M183 at UniProt or InterPro

Protein Sequence (315 amino acids)

>MMP_RS00220 GTP cyclohydrolase MptA (Methanococcus maripaludis S2)
MQCNDVQATEPDIKVSLTRVGVTNLKKLVKLKRKNKRDIVLLPTFEVFVDLPSSQKGIHM
SRSPEVIEEVVENILLEKEIYGVEDLSVEIVMKLFEKHEYATRAEVMLYSDYMMEEKSPV
TKKDSQEIGKIIARAYGVKDSNGKIDVKKMVGAEVVGITACPCAQNMLKENAVVSLTEKG
FSSEDIEKILDSVTIATHNQRGIGTVMIEVPNGYTVGISKIIKIIKDSMSGEVYELLKRS
DEAFVVEAAHKNPKFVEDCAREMIKRVVDVFDYLPEDTQVLVRQVNKESIHRHDAFAERN
STIRELRDELKTLTN