Protein Info for MMP_RS00215 in Methanococcus maripaludis S2

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF13191: AAA_16" amino acids 41 to 191 (151 residues), 38.2 bits, see alignment E=5.5e-13 PF13401: AAA_22" amino acids 66 to 218 (153 residues), 27.1 bits, see alignment E=1.2e-09 PF00004: AAA" amino acids 68 to 242 (175 residues), 27.9 bits, see alignment E=7.5e-10 PF01022: HTH_5" amino acids 335 to 382 (48 residues), 32.1 bits, see alignment 2.1e-11

Best Hits

Swiss-Prot: 69% identical to Y774_METJA: Uncharacterized HTH-type transcriptional regulator MJ0774 (MJ0774) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0033)

Predicted SEED Role

"Uncharacterized HTH-type transcriptional regulator MJ0774"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M184 at UniProt or InterPro

Protein Sequence (408 amino acids)

>MMP_RS00215 AAA family ATPase (Methanococcus maripaludis S2)
MLDPIEFIHNASSISKKSMNRLKLKTNPFSEKPIRGNTKFFVGRTSELSEIADILGAAQY
GSVANAAIVGTKGIGKSSILNILYYASKRHNHWVVELEASQITARQFLIQLMYGIIKDNL
FSVDGTLSSDYMKHSQKIIEIYKRLSNYSDKTPVHYPREKIERDLKYLLNEVKEENKLCV
ILIDEADQFAKRSCLGLLQFFHSFLYEDDILTFLAGPPTMVEDLTKISPAIRDRIPKIIN
MPPLTKEEAYDLIKRRLEDSQITGAKGYQPFSEQSIEKIIEECDGIPRRIIMTCSEAVSL
GLKNGVDEIDDEIARNAMKNLGISVGHQILNHLTPAQSKIIKAMAELGGSSTVTELSGIL
NNSTGTIGTHLSDIYEMGYIYKERDGYNVYYTLSKELKDVLITKEDIS