Protein Info for MMP_RS00190 in Methanococcus maripaludis S2

Annotation: cobyrinic acid a c-diamide synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07685: GATase_3
  • amino acids 30 to 190 (161 residues), 33.3 bits, E=1.9e-12

Best Hits

Swiss-Prot: 57% identical to Y138_METJA: Putative glutamine amidotransferase-like protein MJ0138 (MJ0138) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0028)

Predicted SEED Role

"Cobyrinic acid A,C-diamide synthase" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis

MetaCyc Pathways

• cob(II)yrinate a,c-diamide biosynthesis I (early cobalt insertion) (14/15 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)

Sequence Analysis Tools

See Q6M189 at UniProt or InterPro

Protein Sequence (483 amino acids)

>MMP_RS00190 cobyrinic acid a c-diamide synthase (Methanococcus maripaludis S2)
MEIGLIDIKGTLPCFENFGNLPTKIIHENNISKIKDLEMLIIPGGSIVESGSFTDEFKKQ
ILDFDNYIVGICSGFQILSEKIDIGRKSPIPIIKEGLGLLNVEFSPLICTDLVKFNIEND
NLFGKKNQLGHGFHCHTYGNIEITNNSTKIWTTSEIEKLNYKMVGKQNILSGVFKNKVYG
TMVHNLLDNDFVVENFLKNMKIKDDEKQEIFKKNSILKEKLKDRSKISENFKKIESNDKK
GIILLATGSESGKTFLSTSICSKLKGKTFVSKIGPDVRDIVPSLYLLREPMTKFSSIKLS
DRGWSEPSEFLEFVKNSKFNNYIIEGVMGAFTGALNKKNYSGSEVSKILGFPVYIISSCS
KTGIEGSFVECMAYHSLLKEMGVNVAGIVLNRVYNAELLEKVKKIANDLNIDLIGVNKLN
VNVDNKRGLIPEVEIDYEEFCNATMKLDFEIDIPKINPEKINEDSKTFEEYLKIWSEKLI
NIN