Protein Info for MMP_RS00130 in Methanococcus maripaludis S2
Annotation: nickel-responsive transcriptional regulator NikR
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to NIKR_METMP: Putative nickel-responsive regulator (MMP0020) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K07722, CopG family transcriptional regulator, nickel-responsive regulator (inferred from 98% identity to mmx:MmarC6_0929)Predicted SEED Role
"Nickel responsive regulator NikR" in subsystem Transport of Nickel and Cobalt
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q6M197 at UniProt or InterPro
Protein Sequence (141 amino acids)
>MMP_RS00130 nickel-responsive transcriptional regulator NikR (Methanococcus maripaludis S2) MVDMDRISISLPTNLLAEFDEIIEERGYASRSEAIRDSIRDYLIKHKWIHSLEGERAGTI SIIYDHHSTDVMEKLTNIQHDYEKLIVATIHMHLDHDHCMEVVLVKGDAGEIKELTDKLT SQKGVKQVKLTVMVPGGNIPQ