Protein Info for MMP_RS00065 in Methanococcus maripaludis S2

Annotation: geranylgeranylglyceryl/heptaprenylglyceryl phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01884: PcrB
  • amino acids 14 to 240 (227 residues), 243 bits, E=2.7e-76
• TIGR01769: phosphoglycerol geranylgeranyltransferase
  • amino acids 23 to 225 (203 residues), 272.7 bits, E=2.2e-85
• TIGR01768: geranylgeranylglyceryl phosphate synthase family protein
  • amino acids 24 to 237 (214 residues), 186.4 bits, E=5.5e-59
• PF00977: His_biosynth
  • amino acids 186 to 244 (59 residues), 25.2 bits, E=1e-09

Best Hits

Swiss-Prot: 100% identical to GGGPS_METMP: Geranylgeranylglyceryl phosphate synthase (MMP0007) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K07094, putative glycerol-1-phosphate prenyltransferase [EC: 2.5.1.-] (inferred from 100% identity to mmp:MMP0007)

MetaCyc: 41% identical to phosphoglycerol geranylgeranyltransferase (Methanothermobacter thermautotrophicus Delta H)
Phosphoglycerol geranylgeranyltransferase. [EC: 2.5.1.41]

Predicted SEED Role

"(S)-3-O-geranylgeranylglyceryl phosphate synthase" in subsystem Archaeal lipids

MetaCyc Pathways

• C_20,20 CDP-archaeol biosynthesis (3/6 steps found)
• archaetidylinositol biosynthesis (3/10 steps found)
• archaetidylserine and archaetidylethanolamine biosynthesis (3/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (35/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of terpenoids and steroids
• Carotenoid biosynthesis - General
• Methionine metabolism
• Porphyrin and chlorophyll metabolism
• Riboflavin metabolism
• Terpenoid biosynthesis
• Tryptophan metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.41

Sequence Analysis Tools

See Q6M1A9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>MMP_RS00065 geranylgeranylglyceryl/heptaprenylglyceryl phosphate synthase (Methanococcus maripaludis S2)
MQIKIGEIESKLNKIIEEEGAAYFVLIDPDEKNYREIANHVKDYADAIIIGGSIGIINLD
EVTKDIKEITGLPIILFPGNVDGVTKEADAVFFMSLMNSKNTYWNMTAPTLGALTIKKYG
LETLPMAYLGIEPISKTAVGFVGEVNEIPQKKPEIAGLYSLSASYFGMRWAYLEAGSGAE
YPVSNEMVGISKKLSGINIIVGGGIRTPEVAYEKVMSGADVIVTGTLTEKDPQAVVEMKK
AIKKAGLDKLKMLSKK