Protein Info for MMP_RS00060 in Methanococcus maripaludis S2

Annotation: 3-dehydroquinate synthase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF01959: DHQS" amino acids 2 to 361 (360 residues), 467.4 bits, see alignment E=1.2e-144

Best Hits

Swiss-Prot: 100% identical to DHQS_METMP: 3-dehydroquinate synthase (aroB') from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K11646, dehydroquinate synthase II [EC: 1.4.1.-] (inferred from 100% identity to mmp:MMP0006)

MetaCyc: 69% identical to dehydroquinate synthase II (Methanocaldococcus jannaschii)
RXN-10032 [EC: 1.4.1.24]

Predicted SEED Role

"3,7-dideoxy-D-threo-hepto-2, 6-diulosonate synthase (EC 4.2.3.-)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 4.2.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.1.- or 1.4.1.24 or 4.2.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q6M1B0 at UniProt or InterPro

Protein Sequence (361 amino acids)

>MMP_RS00060 3-dehydroquinate synthase II (Methanococcus maripaludis S2)
MKFGWIKTTGNDLEERMESVKDALESSIPGIIAEKEEISSVRELGNIKIVSDNLDADVVL
INKGEDLEILKSAKLSGKETGVYVVINTKEDEVYATDVSKLDFVDYVVLEGSDWTIIPLE
NIIADLFSEEIKIVSVVTNVKDAEAAYEILEKGVDGVVLIPKDINEVKDFSKLIERMNSE
SVKLDYATVTKIEPVGSGDRVCIDTCSMMEMGEGMLIGSYSRGMFLVHSETVENPYVATR
PFRVNAGPVHAYILCPENKTKYLSDLKAGDKVLVVNKNGETREAIIGRVKIEKRPLFLVE
AEYNGENLRTILQNAETIRLVGEDGKPVSVVDLKVGTKVLIKPDENARHFGMAIKETIIE
K