Protein Info for MMJJ_RS09010 in Methanococcus maripaludis JJ

Annotation: 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF02590: SPOUT_MTase" amino acids 1 to 158 (158 residues), 190.6 bits, see alignment E=9.3e-61 TIGR00246: rRNA large subunit m3Psi methyltransferase RlmH" amino acids 2 to 159 (158 residues), 173.1 bits, see alignment E=2e-55

Best Hits

Swiss-Prot: 100% identical to RLMH_METMP: Putative ribosomal RNA large subunit methyltransferase H (rlmH) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00783, hypothetical protein (inferred from 100% identity to mmp:MMP1037)

Predicted SEED Role

"LSU m3Psi1915 methyltransferase RlmH" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (159 amino acids)

>MMJJ_RS09010 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH (Methanococcus maripaludis JJ)
MNVTIISVGKIKEKYLSDAIIEYSKRISRYSKLDIIEVADEKTPENPSDVEKSKILEKEA
ERILKYLKKDSFLITLEILGKELTSEDLAKKINDLSISGKSDITFVIGGSLGLSKNISEI
SDFKLSFSKMTFPHQLMRVILLEQIYRSFRIISGEPYHK