Protein Info for MMJJ_RS08855 in Methanococcus maripaludis JJ

Annotation: cyclic pyranopterin monophosphate synthase MoaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 TIGR00581: molybdenum cofactor biosynthesis protein C" amino acids 2 to 143 (142 residues), 174.1 bits, see alignment E=8.1e-56 PF01967: MoaC" amino acids 12 to 150 (139 residues), 164.5 bits, see alignment E=6.9e-53

Best Hits

Swiss-Prot: 68% identical to MOAC_METJA: Probable cyclic pyranopterin monophosphate synthase (moaC) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03637, molybdenum cofactor biosynthesis protein C (inferred from 96% identity to mmz:MmarC7_0319)

MetaCyc: 40% identical to MoaC monomer (Thermus thermophilus HB8)
RXN-17809 [EC: 4.6.1.17]

Predicted SEED Role

"Molybdenum cofactor biosynthesis protein MoaC" in subsystem Molybdenum cofactor biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.6.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>MMJJ_RS08855 cyclic pyranopterin monophosphate synthase MoaC (Methanococcus maripaludis JJ)
MLTHVDENGVKMVDVSNKKDVERICTAVGFIKLKKSTIEKITKKELIKGDVLTTAQVAGV
MAVKNTSNIIPMCHPLPIESIKVNFEIFEDRIKAETRVKATYKTGIEMESLTGVSVALLT
IWDMVKAIEKDEFGQYPDTQIYGIEVTEKIKKE