Protein Info for MMJJ_RS08690 in Methanococcus maripaludis JJ

Annotation: phosphate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02136: phosphate binding protein" amino acids 1 to 278 (278 residues), 235.3 bits, see alignment E=4.4e-74 PF12849: PBP_like_2" amino acids 37 to 266 (230 residues), 150.1 bits, see alignment E=1.7e-47 PF13531: SBP_bac_11" amino acids 43 to 276 (234 residues), 35 bits, see alignment E=2e-12 PF12727: PBP_like" amino acids 57 to 222 (166 residues), 35.5 bits, see alignment E=8.6e-13

Best Hits

KEGG orthology group: K02040, phosphate transport system substrate-binding protein (inferred from 92% identity to mmp:MMP1095)

Predicted SEED Role

"Phosphate ABC transporter, periplasmic phosphate-binding protein PstS (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>MMJJ_RS08690 phosphate ABC transporter substrate-binding protein (Methanococcus maripaludis JJ)
MKKYISVLIGAVFIALIVGLSGCTESTNGSDNVEVQKVSLKISGSTTVLPIAEEAAKQFM
IANKNYMIEVTGGGSGLGVKEAGENLNDIGMASRDVKSSEFEIYPSLQVFGIAKDGVAII
VQPENPVSSLTQEQVIAIYSGEITNWNEVGGNDAPITVYTRDEESGTREVFFEKALNKGN
ITKKAVVVASNGAMKSSVKADVNGIGYLSIGYLDSSVKGCEYEGVIPTEANVISGTYKVS
RTLNVITNGEPSQEVKAFIDFLLSSEGQKIVAEEGYIQVN