Protein Info for MMJJ_RS08630 in Methanococcus maripaludis JJ

Annotation: signal recognition particle subunit SRP19/SEC65 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 89 PF01922: SRP19" amino acids 5 to 88 (84 residues), 82 bits, see alignment E=2.2e-27

Best Hits

Swiss-Prot: 97% identical to SRP19_METMP: Signal recognition particle 19 kDa protein (srp19) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03105, signal recognition particle subunit SRP19 (inferred from 97% identity to mmp:MMP1107)

Predicted SEED Role

"Signal recognition particle protein SRP19"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (89 amino acids)

>MMJJ_RS08630 signal recognition particle subunit SRP19/SEC65 family protein (Methanococcus maripaludis JJ)
MKEIILWPAYIDLKRTKNEGRKVPKEIAVQNPKLKDIASKIKKMGLEYSVENKKSYPKES
WEICGYIKVKVDESTSKLQFLKEICNNMK