Protein Info for MMJJ_RS08240 in Methanococcus maripaludis JJ

Annotation: L-fuculose phosphate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 98% identical to FUCA_METMP: L-fuculose phosphate aldolase (fucA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01628, L-fuculose-phosphate aldolase [EC: 4.1.2.17] (inferred from 98% identity to mmp:MMP1187)

MetaCyc: 61% identical to fuculose-1-phosphate aldolase subunit (Methanocaldococcus jannaschii)
L-fuculose-phosphate aldolase. [EC: 4.1.2.17]

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

MetaCyc Pathways

lactate biosynthesis (archaea) (4/5 steps found)
L-fucose degradation I (2/4 steps found)
D-arabinose degradation II (1/4 steps found)
nucleoside and nucleotide degradation (halobacteria) (2/6 steps found)
superpathway of fucose and rhamnose degradation (4/12 steps found)
superpathway of pentose and pentitol degradation (3/42 steps found)

KEGG Metabolic Maps

Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>MMJJ_RS08240 L-fuculose phosphate aldolase (Methanococcus maripaludis JJ)
MDLTEFIKICRLLYDRKYVVGSGGNVSIRDGNLIYITPTGLSLGFLTKEDICIADLNGNI
IKGKPTSELNMHLKIYQNKDLINAVVHTHSMYCTAFSTLDKKLKLVTPEAEMVVKKIAYV
DYFPCGSLELAENVSKCLEDSIILKNHGIVTLGKDITEAYIKTEVLEEVAQLNYIMNNLK