Protein Info for MMJJ_RS08220 in Methanococcus maripaludis JJ
Annotation: methenyltetrahydromethanopterin cyclohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to MCH_METMP: Methenyltetrahydromethanopterin cyclohydrolase (mch) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K01499, methenyltetrahydromethanopterin cyclohydrolase [EC: 3.5.4.27] (inferred from 100% identity to mmp:MMP1191)Predicted SEED Role
"N(5),N(10)-methenyltetrahydromethanopterin cyclohydrolase (EC 3.5.4.27)" in subsystem Methanogenesis or One-carbon metabolism by tetrahydropterines or Serine-glyoxylate cycle (EC 3.5.4.27)
MetaCyc Pathways
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
- methanogenesis from H2 and CO2 (6/6 steps found)
- methyl-coenzyme M oxidation to CO2 II (6/6 steps found)
- methyl-coenzyme M oxidation to CO2 I (5/6 steps found)
- reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
- methoxylated aromatic compound degradation II (6/9 steps found)
- formaldehyde oxidation VI (H4MPT pathway) (1/4 steps found)
- superpathway of methanogenesis (11/21 steps found)
- superpathway of C1 compounds oxidation to CO2 (3/12 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.4.27
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (323 amino acids)
>MMJJ_RS08220 methenyltetrahydromethanopterin cyclohydrolase (Methanococcus maripaludis JJ) MLSVNLASLPIVEEMISRKEDLNIEVIKLENGATVLDCGVNVMGSFEAGKLFTKICLGGL AHVGISISGSLDNKLVLPCVKIKTSHPAIATLGSQKAGWSVSVGKYFAMGSGPARALAMM PKATYEEIDYRDEADVAILCLESSQLPDENVADHVAEKCGVDVSKVYLLVAPTASMVGAV QISGRVVENGTYKMLEALHFDVRKVKFAAGIAPVAPVIGDDLKMMGATNDMVLYGGRTFY YVKSDEGDDIENLCKSLPSCSAETYGKPFLDVFKEANYDFYKIDKGMFAPAIVTINDLRT GKLMSYGETNVDVLKKSLKFSQL