Protein Info for MMJJ_RS08110 in Methanococcus maripaludis JJ

Annotation: thiolase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 PF00108: Thiolase_N" amino acids 4 to 221 (218 residues), 101.9 bits, see alignment E=6e-33 PF00109: ketoacyl-synt" amino acids 78 to 117 (40 residues), 26.3 bits, see alignment 8.2e-10 PF02803: Thiolase_C" amino acids 259 to 359 (101 residues), 43.9 bits, see alignment E=2.6e-15

Best Hits

Swiss-Prot: 77% identical to Y1549_METJA: Uncharacterized protein MJ1549 (MJ1549) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 100% identity to mmp:MMP1212)

MetaCyc: 85% identical to acetyl-CoA C-acetyltransferase (Methanothermococcus thermolithotrophicus)
Acetyl-CoA C-acyltransferase. [EC: 2.3.1.16, 2.3.1.9]

Predicted SEED Role

"nonspecific lipid-transfer protein (acethyl CoA synthetase)" in subsystem Ketoisovalerate oxidoreductase

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.16 or 2.3.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (392 amino acids)

>MMJJ_RS08110 thiolase domain-containing protein (Methanococcus maripaludis JJ)
MKDVAIIGYGQTKFGELWEESFRSLIVEAGVKAISDANVDGDDIDAMYVGTMSGGLFVGQ
EHSASLIADYAGLNPVPCTRVEAACASGSLALRSACLSIASGAHDVVLVGGVEKMTDVAD
ATSAIATASDQEWEAFVGATFPSLYAMMAKRYMHEYGLTIEQLSSWSAIAHENAVHNKYA
QFRSKVTIDQVMRASPVADPLTLLHCSPVSDGASALIICDAEKATEYAPKDEIIYIKAST
QASDTIALHDRKDMTTLNAAKVASDKAYKIAGIDAKKVDVAEVHDCFAINGLVLTEDLGF
CKKGDAGKVVESGKTRIDDESFVTVNPSGGLKAAGHALGATGIRQVGELYWQLKQDKECK
DRQAAIKNGYAIAANVGGTGGTVCTHVLSNKR