Protein Info for MMJJ_RS08110 in Methanococcus maripaludis JJ
Annotation: thiolase domain-containing protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to Y1549_METJA: Uncharacterized protein MJ1549 (MJ1549) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K00626, acetyl-CoA C-acetyltransferase [EC: 2.3.1.9] (inferred from 100% identity to mmp:MMP1212)MetaCyc: 85% identical to acetyl-CoA C-acetyltransferase (Methanothermococcus thermolithotrophicus)
Acetyl-CoA C-acyltransferase. [EC: 2.3.1.16, 2.3.1.9]
Predicted SEED Role
"nonspecific lipid-transfer protein (acethyl CoA synthetase)" in subsystem Ketoisovalerate oxidoreductase
MetaCyc Pathways
- superpathway of geranylgeranyldiphosphate biosynthesis I (via mevalonate) (8/10 steps found)
- mevalonate pathway I (eukaryotes and bacteria) (5/7 steps found)
- mevalonate pathway II (haloarchaea) (5/7 steps found)
- acetoacetate degradation (to acetyl CoA) (1/2 steps found)
- isoprene biosynthesis II (engineered) (5/8 steps found)
- mevalonate pathway IV (archaea) (5/8 steps found)
- ketolysis (1/3 steps found)
- polyhydroxybutanoate biosynthesis (1/3 steps found)
- isopropanol biosynthesis (engineered) (2/5 steps found)
- ketogenesis (2/5 steps found)
- pyruvate fermentation to acetone (2/5 steps found)
- mevalonate pathway III (Thermoplasma) (4/8 steps found)
- (2S)-ethylmalonyl-CoA biosynthesis (1/4 steps found)
- (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (1/5 steps found)
- glutaryl-CoA degradation (1/5 steps found)
- pyruvate fermentation to butanoate (2/7 steps found)
- L-isoleucine degradation I (1/6 steps found)
- fatty acid salvage (1/6 steps found)
- pyruvate fermentation to butanol II (engineered) (1/6 steps found)
- glycerol degradation to butanol (8/16 steps found)
- 2-deoxy-D-ribose degradation II (2/8 steps found)
- pyruvate fermentation to butanol I (2/8 steps found)
- acetyl-CoA fermentation to butanoate (1/7 steps found)
- superpathway of Clostridium acetobutylicum acidogenic fermentation (2/9 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
- 2-methylpropene degradation (1/8 steps found)
- pyruvate fermentation to hexanol (engineered) (3/11 steps found)
- L-lysine fermentation to acetate and butanoate (2/10 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
- 4-oxopentanoate degradation (1/9 steps found)
- valproate β-oxidation (1/9 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
- L-glutamate degradation V (via hydroxyglutarate) (1/10 steps found)
- methyl tert-butyl ether degradation (1/10 steps found)
- L-glutamate degradation VII (to butanoate) (2/12 steps found)
- ethylmalonyl-CoA pathway (1/11 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (2/13 steps found)
- superpathway of glyoxylate cycle and fatty acid degradation (2/14 steps found)
- 3-hydroxypropanoate/4-hydroxybutanate cycle (4/18 steps found)
- crotonate fermentation (to acetate and cyclohexane carboxylate) (2/16 steps found)
- L-tryptophan degradation III (eukaryotic) (1/15 steps found)
- benzoate fermentation (to acetate and cyclohexane carboxylate) (2/17 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (2/17 steps found)
- superpathway of ergosterol biosynthesis I (7/26 steps found)
- toluene degradation VI (anaerobic) (1/18 steps found)
- platensimycin biosynthesis (3/26 steps found)
- superpathway of cholesterol biosynthesis (7/38 steps found)
- oleate β-oxidation (3/35 steps found)
- superpathway of L-lysine degradation (5/43 steps found)
KEGG Metabolic Maps
- Benzoate degradation via CoA ligation
- Benzoate degradation via hydroxylation
- Biosynthesis of plant hormones
- Biosynthesis of unsaturated fatty acids
- Butanoate metabolism
- Ethylbenzene degradation
- Fatty acid elongation in mitochondria
- Fatty acid metabolism
- Geraniol degradation
- Lysine degradation
- Propanoate metabolism
- Pyruvate metabolism
- Synthesis and degradation of ketone bodies
- Terpenoid biosynthesis
- Tryptophan metabolism
- Valine, leucine and isoleucine degradation
- alpha-Linolenic acid metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.3.1.16 or 2.3.1.9
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (392 amino acids)
>MMJJ_RS08110 thiolase domain-containing protein (Methanococcus maripaludis JJ) MKDVAIIGYGQTKFGELWEESFRSLIVEAGVKAISDANVDGDDIDAMYVGTMSGGLFVGQ EHSASLIADYAGLNPVPCTRVEAACASGSLALRSACLSIASGAHDVVLVGGVEKMTDVAD ATSAIATASDQEWEAFVGATFPSLYAMMAKRYMHEYGLTIEQLSSWSAIAHENAVHNKYA QFRSKVTIDQVMRASPVADPLTLLHCSPVSDGASALIICDAEKATEYAPKDEIIYIKAST QASDTIALHDRKDMTTLNAAKVASDKAYKIAGIDAKKVDVAEVHDCFAINGLVLTEDLGF CKKGDAGKVVESGKTRIDDESFVTVNPSGGLKAAGHALGATGIRQVGELYWQLKQDKECK DRQAAIKNGYAIAANVGGTGGTVCTHVLSNKR