Protein Info for MMJJ_RS08080 in Methanococcus maripaludis JJ

Annotation: TIGR00300 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 346 to 367 (22 residues), see Phobius details amino acids 387 to 405 (19 residues), see Phobius details TIGR00300: TIGR00300 family protein" amino acids 1 to 411 (411 residues), 651.1 bits, see alignment E=3.2e-200 PF04455: Saccharop_dh_N" amino acids 4 to 102 (99 residues), 125.6 bits, see alignment E=1.4e-40 PF21571: ArgZ-like_C_1st" amino acids 103 to 186 (84 residues), 117.6 bits, see alignment E=2.8e-38 PF21570: ArgZ-like_C_2nd" amino acids 187 to 404 (218 residues), 348.6 bits, see alignment E=2.1e-108

Best Hits

Swiss-Prot: 69% identical to Y1480_METJA: Uncharacterized protein MJ1480 (MJ1480) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 99% identity to mmp:MMP1218)

Predicted SEED Role

"Uncharacterized protein MJ1480"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (415 amino acids)

>MMJJ_RS08080 TIGR00300 family protein (Methanococcus maripaludis JJ)
MFMREIELKGHIIDSFILAKVFDRTLELGGDYKVLEFDIGKKKIDTSYAKLLISGNTQQH
LDQILEELQNVGANIPEIENANLKPALKDSVLPDGFYSTTNHPTHVKVNDEWIEVANPKM
DAVIVVYPEEKRAETKVIRKVKKGDFVLIGHNGIRVMPPEKSREAGQLFEFMNSEVSSEK
PKEAIIKRIAKEMHEIREEYKKTGTGGIAIVGGPAIIHTGGGPALAKMVELGYIQAILAG
NALATHDIESALYGTSLGVNIKTAKPVTGGHKHHIYAINAINDAGNIKNAVESGVLKEGI
MYQCIKNNVPYVLAGSIRDDGPIPDVITDAMVAQDKMRTTVMDKKMVIMLSTLLHSVATG
NLMPSYIKTVCVDIQPSTVTKLMDRGTSQAIGVVTDVGVFLVLLLKELERLELQE