Protein Info for MMJJ_RS08060 in Methanococcus maripaludis JJ

Annotation: DNA repair and recombination protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF14520: HHH_5" amino acids 4 to 58 (55 residues), 50.7 bits, see alignment E=5e-17 TIGR02236: DNA repair and recombination protein RadA" amino acids 5 to 322 (318 residues), 484.7 bits, see alignment E=6.5e-150 PF00154: RecA" amino acids 72 to 293 (222 residues), 31.8 bits, see alignment E=2.7e-11 PF08423: Rad51" amino acids 73 to 322 (250 residues), 269.6 bits, see alignment E=5.6e-84 PF13481: AAA_25" amino acids 81 to 258 (178 residues), 32.7 bits, see alignment E=1.4e-11

Best Hits

Swiss-Prot: 100% identical to RADA_METMP: DNA repair and recombination protein RadA (radA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K04483, DNA repair protein RadA (inferred from 100% identity to mmp:MMP1222)

Predicted SEED Role

"DNA repair and recombination protein RadA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>MMJJ_RS08060 DNA repair and recombination protein RadA (Methanococcus maripaludis JJ)
MADVLTELPGVGPSTADKLIEGGYLDFMKIATATIGELTDIEGISEKAAAKMIMAARDLC
DLGFKSGVELLKQRQSVWRLSTGSTELDTVLAGGIESQSVTEFAGMFGSGKTQIMHQTCV
NLQMREKIFADLEGVVEEELEAPKAVYIDTEGTFRPERVVQMAEGAGIDGQTVLDNTFVA
RAYNSDMQMLFAEKIEDLIKGGNNIKLVIIDSLTSTFRNEFTGRGKLAERQQKLGRHMAT
LNKLADLYNCIVLVTNQVAAKPDAYFGVAEQAIGGHVVGHAATFRFFLRKSKGDKRVAKL
YDSPHLPDSEAVFRITEKGIQD