Protein Info for MMJJ_RS07925 in Methanococcus maripaludis JJ

Annotation: formylmethanofuran dehydrogenase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 TIGR03122: formylmethanofuran dehydrogenase subunit C" amino acids 4 to 262 (259 residues), 345.1 bits, see alignment E=1.1e-107 PF01493: GXGXG" amino acids 66 to 209 (144 residues), 41 bits, see alignment E=8e-15

Best Hits

Swiss-Prot: 98% identical to FWDC_METMP: Tungsten-containing formylmethanofuran dehydrogenase 2 subunit C (fwdC) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00202, formylmethanofuran dehydrogenase subunit C [EC: 1.2.99.5] (inferred from 98% identity to mmp:MMP1249)

Predicted SEED Role

"Formylmethanofuran dehydrogenase (tungsten) subunit C (EC 1.2.99.5)" in subsystem Methanogenesis (EC 1.2.99.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.99.5

Use Curated BLAST to search for 1.2.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (272 amino acids)

>MMJJ_RS07925 formylmethanofuran dehydrogenase subunit C (Methanococcus maripaludis JJ)
MNELILNLKGDVSVPVEMDKIIPEKIQEMSLEEISGIELIQGNKTAKVSEIFDVELKESP
VSKVTINNCCKKVKRIGEKMTSGEIVVNGDAGMYVGVEMKGGKITVNGDAESWVGQNLKG
GEIIINGNAENYVGSAYRGDWRGMSGGKITITGNAGSELGEYLKGGTIVIKGNTKIMPGI
HQNGGMIIIEGDIEGRAGGEMMKGAIVVYGKILEPLPSFKFEGIVEDPLVKLSKKDAGTQ
LKGTFIKFSGDYVNTKPKGQLYAAIENNKNLI