Protein Info for MMJJ_RS07805 in Methanococcus maripaludis JJ
Annotation: ferredoxin family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 74% identical to VORC_METTH: Ketoisovalerate oxidoreductase subunit VorC (vorC) from Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H)
KEGG orthology group: K00188, 2-oxoisovalerate ferredoxin oxidoreductase, delta subunit [EC: 1.2.7.7] (inferred from 100% identity to mmp:MMP1273)Predicted SEED Role
"Ketoisovalerate oxidoreductase subunit VorC (EC 1.2.7.7)" in subsystem Ketoisovalerate oxidoreductase (EC 1.2.7.7)
MetaCyc Pathways
- L-isoleucine biosynthesis V (3/3 steps found)
- L-isoleucine biosynthesis IV (5/6 steps found)
- L-isoleucine degradation III (oxidative Stickland reaction) (2/3 steps found)
- L-leucine degradation V (oxidative Stickland reaction) (2/3 steps found)
- L-valine degradation III (oxidative Stickland reaction) (2/3 steps found)
- 2-oxobutanoate degradation II (1/2 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.2.7.7
Use Curated BLAST to search for 1.2.7.7
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (79 amino acids)
>MMJJ_RS07805 ferredoxin family protein (Methanococcus maripaludis JJ) MECSTKKPYPVINALECKACERCIIACPKDVLKMSKDCNERGYNYVIYTGEGCTGCGNCY YTCPEPLAIEVHIPLKKCE