Protein Info for MMJJ_RS07275 in Methanococcus maripaludis JJ
Annotation: formate--phosphoribosylaminoimidazolecarboxamide ligase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to PURP_METMP: 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase (purP) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K06863, 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase [EC: 6.3.4.-] (inferred from 99% identity to mmp:MMP1373)MetaCyc: 77% identical to FAICAR synthetase monomer (Methanocaldococcus jannaschii)
RXN-10066 [EC: 6.3.4.23]
Predicted SEED Role
"Phosphoribosylaminoimidazolecarboxamide formyltransferase [alternate form]" in subsystem De Novo Purine Biosynthesis
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
 - superpathway of purine nucleotides de novo biosynthesis I (17/21 steps found)
 - inosine-5'-phosphate biosynthesis III (5/6 steps found)
 - inosine-5'-phosphate biosynthesis II (4/5 steps found)
 - inosine-5'-phosphate biosynthesis I (4/6 steps found)
 - superpathway of purine nucleotides de novo biosynthesis II (17/26 steps found)
 
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 6.3.4.- or 6.3.4.23
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (361 amino acids)
>MMJJ_RS07275 formate--phosphoribosylaminoimidazolecarboxamide ligase (Methanococcus maripaludis JJ) MIPKEEIMGIFEKYNKDEVTIVTVGSHTSLHILKGAKLEGFSTAVITTKDRAIPYKRFGV ADKFIYVDQFSDISKEEIQQQLRDMNAIIVPHGSFIAYCGLDNVEDTFKVPMFGNRAILR WEAERDLEGRLLGGSGLRIPKKYGGPDEIDGPVMVKFPGARGGRGYFPCSSVEEFWRKIG EFKAKGVLTEDDVSKAHIEEYVVGANYCIHYFYSPLKDQVELMGIDRRYESSIDGLVRVP AKDQLELNIDPSYVITGNFPVVIRESLLPQVFDMGDKLVAKAKEEVNPGMLGPFCLQSLC NDNLELVVFEMSARVDGGTNTFMNGSPYSCLYTGEPLSMGQRIAKEIKLALELNMIDKVI S