Protein Info for MMJJ_RS07250 in Methanococcus maripaludis JJ
Annotation: thymidylate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 58% identical to TYSY_METJA: Putative thymidylate synthase (thyA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K00560, thymidylate synthase [EC: 2.1.1.45] (inferred from 96% identity to mmx:MmarC6_1294)Predicted SEED Role
"Thymidylate synthase (EC 2.1.1.45)" in subsystem Folate Biosynthesis (EC 2.1.1.45)
MetaCyc Pathways
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (15/18 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (7/9 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis II (5/7 steps found)
- pyrimidine deoxyribonucleotides biosynthesis from CTP (5/8 steps found)
- dTMP de novo biosynthesis (mitochondrial) (1/3 steps found)
- superpathway of pyrimidine deoxyribonucleoside salvage (5/9 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (8/14 steps found)
- pyrimidine deoxyribonucleosides salvage (1/5 steps found)
- folate transformations III (E. coli) (1/9 steps found)
- folate transformations II (plants) (1/11 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.1.1.45
Use Curated BLAST to search for 2.1.1.45
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (210 amino acids)
>MMJJ_RS07250 thymidylate synthase (Methanococcus maripaludis JJ) MLALKKKSVKSAFEALIPKIMEEGTEMITEDGQKCKEIMNTIIEINDPSDKSISEKYPLG ERAVKSYTEQLLHGSGATFVYDYHERIFEYPNEKKELKNDQIEYIVNKLKEQINSRRAVA ITWNPYIDQTVKDVPCLQIVQFLVRDNKLYQTVLFRSNDAFLAFHANAIGLIALGEMVAE KLGIELVKYTHHSVSMHVYFERDSDALKKF