Protein Info for MMJJ_RS07240 in Methanococcus maripaludis JJ

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF00753: Lactamase_B" amino acids 16 to 159 (144 residues), 54.5 bits, see alignment E=5.5e-18 PF23023: Anti-Pycsar_Apyc1" amino acids 20 to 164 (145 residues), 51.2 bits, see alignment E=5.2e-17 PF16661: Lactamase_B_6" amino acids 23 to 167 (145 residues), 42.4 bits, see alignment E=1.8e-14 PF12706: Lactamase_B_2" amino acids 26 to 181 (156 residues), 36.7 bits, see alignment E=1.2e-12 PF10996: Beta-Casp" amino acids 223 to 337 (115 residues), 81.6 bits, see alignment E=2.5e-26 PF07521: RMMBL" amino acids 351 to 412 (62 residues), 51.7 bits, see alignment E=2.5e-17

Best Hits

Swiss-Prot: 68% identical to Y162_METJA: Uncharacterized protein MJ0162 (MJ0162) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to mmp:MMP1381)

Predicted SEED Role

"Protein similar to polyadenylation specificity factor, MJ0162 type"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>MMJJ_RS07240 MBL fold metallo-hydrolase (Methanococcus maripaludis JJ)
MTIAKFHGGCHQIGKSCVEINTKKSKILIDCGMDPSDNGLPDINDSDVDAVVVSHAHLDH
CGAIPYFNFKKIFCNPPTADLMYNVWKDTVSLSKTYKEEDIKKSMDVIKTVNYREEKQVT
SDIKMKMYDAGHILGSSSLYLDIDGKKLLYTGDINEIETRTLRAADTDFDEIDTIIIEST
YGSPLDIKPARKVLEKQLIDEISETIDNGGKVIIPVFAVGRSQEIIVVINNYMKSGALKE
VPIYINGSLTHTTGMYMGYSDWLNPKIKNAIENRINPFGNLIKGGDEVFSREPCIIISTS
GMVQGGPVLQYLSLLKNPRNKIILTGYQAEGTIGRSLEEGATEVKPFKRAIPVNGKVVKI
EFSAHADYNSLLRFMKKIPQPDKAIVMHGERYQALSLAMTIWKTLKIPALAPSIGSVLPL
FD